PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa009150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 364aa    MW: 40100.4 Da    PI: 8.5446
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-12095PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1023.5e-32101152253
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGg 53 
                ++k+l+cprC s++tkfCyynny+++qPr+fCk+C+ryWt+GG++r +P   
  Lsa009150 101 PDKILPCPRCTSMDTKFCYYNNYNVNQPRHFCKSCQRYWTAGGTMRSMPAEQ 152
                7899********************************************9654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-2598160IPR003851Zinc finger, Dof-type
PfamPF027012.1E-27103153IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.574105159IPR003851Zinc finger, Dof-type
PROSITE patternPS013610107143IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MEDPGIKLFG KKIVLPEFSK SINLPVIFTG GGDNKDGDSD HKCFQGERVT REPPEKDQQK  60
VRSSPKAMAE ASNPRTPSID EEAGTAKSDA TNSQPKTLKK PDKILPCPRC TSMDTKFCYY  120
NNYNVNQPRH FCKSCQRYWT AGGTMRSMPA EQVAGKTRTR PLIVVNSPSP QEAFQAAAPP  180
PQAEVAATSD RTVTASDSVT ENGLNSKVSC PPNPTVSWPY SPWNPTIPIP AICPPIPIHP  240
STYWNSIPFL PPLTPARTLT SHPCEPILGK HSRDDVLINH NDSEDDLKKP KNLVLIPKTL  300
RIDDPDEAAK SSIWATLGIK NENFKAFQEK GEEKKKNSVT RTSSSFLQAN PAAFSRSLCF  360
QETV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A103XXQ51e-141A0A103XXQ5_CYNCS; Zinc finger, Dof-type